PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0048s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family CPP
Protein Properties Length: 1121aa    MW: 111253 Da    PI: 6.3231
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0048s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.31.7e-1498136342
                  TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                          +k+CnCk+s+Clk+YCeCfa+g++C++ C+C +C+N++e+
  Vocar.0048s0009.1.p  98 RKQCNCKNSRCLKLYCECFASGRYCEN-CNCVQCFNNREH 136
                          699***********************9.********9986 PP

2TCR53.25.8e-17182221241
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                          + kgCnCkks+ClkkYCeCf+ag +Cs++CkC +CkN ee
  Vocar.0048s0009.1.p 182 HLKGCNCKKSSCLKKYCECFQAGIYCSDNCKCVECKNYEE 221
                          789**********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-1596136IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.14997221IPR005172CRC domain
PfamPF036382.4E-1099133IPR005172CRC domain
SMARTSM011143.1E-20181222IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.7E-13184219IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1121 aa     Download sequence    Send to blast
MDASNGPPVD SRLIAAPTVA PPLGVRPMAQ SMLSQSLAPQ LGLQGLAASF RPGQFPPAAA  60
SGLPLFQAQA GNMTAQSLGA RKTSMERSKG SGGAGAGRKQ CNCKNSRCLK LYCECFASGR  120
YCENCNCVQC FNNREHEATR QSAVEAILER NPNAFRPKIQ SNEQAPAAAA AVVNNAAAPG  180
RHLKGCNCKK SSCLKKYCEC FQAGIYCSDN CKCVECKNYE EAGSGAGGGA KRIRYGSAPP  240
PSVPPQLGGL VGAGGPQAMT LGAIRPGLVQ SGGFGALVQQ QHAAGVSGLQ MGLVGAMAAA  300
AAAAGATAPG GGARPGGPHS MIGSLASLGP GGMAALPQAL SLALAAASGS APQLLSLQSA  360
AQGTQPGTSL LVAPGGAALA PSAVVPLPLR AKMQEVVNGM VKRSVIEELC RLLWMVADDE  420
AAPARSMTTG AAAAGAGGAT GSSGGAATSQ VDGLPSWADK PAAGAQANGS AGGGAMHGVG  480
PLGKDSAGGG RHDEGALLSQ PDGAAAAAAG DIANGIACDD SGEGNGSGAA GGAVFVKLES  540
GDGMESHQLG GLQPLAQPPP LPVLSNGDGG ADDMAAEAEL LAEGEQSQGA GGTAAAGAAT  600
AGPGPWAAAQ GAREAGDATT DRVEHHGQGS PGFEPQEQQQ QQPPQQQQLP PPPPRRPSLL  660
YGRKERVVLE EFLSIMNKIG DTAAKKLQQH GVVIAAQASL SSLQQQSQTQ AMPLAATAAG  720
AAGGPLPPYG YTQTVPIVAP SSLPGAAAQQ QQQQQQQQPP SALAAAAGAC AVTGPGGAYP  780
AIIRPPGGGG GQVAMMAPTG FPNGQAMYPV GTYPAPGVGA AGPAGGGVAT ASAAAAAQLG  840
HQTLPYGSAG MAAGPDGVVV VAPPASSLVG SATAPGVVEA DQQQQPQQHH LHAMHGGVPV  900
ILAPPRGSHT SITSGALPPP LSHTLQQQQQ LQHHQNQHQL PQPQLPQQPL NVYDDPQHPA  960
SVSAPFSTPF LPYSTDLAMQ PGTIGDDQPQ HHPLQQHPGQ QGEAHPTQPQ QHQEFLQQPE  1020
QQTEALLPGL MVVSEGEQLA GALWSPTAAG QAMLLQPHPL LQSSQPQAAP GVAAIGGGTV  1080
CAAGLPAAQG ADQPMADVDS HGSSGGGGGC NADVMDTTAL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002957163.10.0TSO1-like protein
TrEMBLD8UER50.0D8UER5_VOLCA; TSO1-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3231530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.16e-49Tesmin/TSO1-like CXC domain-containing protein